Catalogue of two collections of Sanskrit manuscripts preserved in the India office library / compiled by Charles H. Tawney, and F.W. Thomas.

  • Great Britain. India Office. Library
Date:
1903
Catalogue details

Licence: Public Domain Mark

Credit: Catalogue of two collections of Sanskrit manuscripts preserved in the India office library / compiled by Charles H. Tawney, and F.W. Thomas. Source: Wellcome Collection.

    17/68 (page 13)
    ASTRONOMY. 43 The work published at Calcutta 1853 and 1868, under the _ title “ Dravyagefiadarpana” or ‘ Rajavallabha”’ by Narayana Kaviraja, appears to be partly the same, though arranged on an entirely different principle. ASTRONOMY. No. XXV. W. 28. Siddhantasiromani of Bhaskaracarya with his own com- mentary the Vasanabhashya. Foll., 13972; nine lines in a page. Fairly correct. Size Cmm. 32x11]. Fair Devanagari writing of the end of the eighteenth century, on India paper. This MS., like the India Office MS. No. 1046 (Eggeling’s Catalogue, p. 1014a), contains the Ganitadhyaya (Poll. 139), and the Goladhyaya, Foll. 72), being the last two chapesers, the 4th and 5th of the Siddhan- tasiromani, z.e., the astronomical portion of the work. It differs from that MS. in having the author’s genealogy in its right place at the end of the prasnadhyaya. Written in Samvat 1846, Vaisakhasudi 7, by Bhavanirama_ at Benares. Professor Eggeling (l.c.) has enumerated the editions of this book. To his list may be added Pandita Candra Deva’s revised edition of his master’s work, published at Benares in 1891. EPIC POETRY. No, XXVI. W. la. Mahabharata, including the Harivamsa, in eight volumes. (iood Devanagari writing of the end of the eighteenth century, on Indian paper. ‘The size varies in different volumes and even in different parvans. The number of lines in a page varies throughout. Correct. The whole MS. is evidently the work of one scribe. The contents of the eight volumes are as follows :— - Vol. I.--(a) Adi Parvan. Foll. 356. Size Cmm. 38, 8x18, 7. The text, with the commentary of Nilakantha the son of Govinda Sari. ‘the commentary is called Bharatabhavadipa. Colophon of commentary :—Iti srimatpadavakyapramanamaryadadhu- ravdharacaturdharavamsavatamsagovindastristinoh Sri Nilakanthasya kritau Bharatabbavadipe Adiparvani Khandavadaharthaprakasah. Samaptasciyam Adiparvani Bhavadipah. The date of writing is given as WeJnesday of the white fortnight of Magha Samvat 1840.